PDBe-KB: UniProt Coverage View:
P00442
![Superoxide dismutase [Cu-Zn] in PDB entry 1sxs, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/1sxs_entity_1_front_image-200x200.png "Homo dimeric assembly 1 of PDB entry <span class='highlight'>1sxs</span> contains 2 copies of <span class='highlight'>Superoxide dismutase [Cu-Zn]</span>. Front view.")
![Superoxide dismutase [Cu-Zn] in PDB entry 1sxs, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/1sxs_entity_1_side_image-200x200.png "Homo dimeric assembly 1 of PDB entry <span class='highlight'>1sxs</span> contains 2 copies of <span class='highlight'>Superoxide dismutase [Cu-Zn]</span>. Side view.")
![Superoxide dismutase [Cu-Zn] in PDB entry 1sxs, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/1sxs_entity_1_top_image-200x200.png "Homo dimeric assembly 1 of PDB entry <span class='highlight'>1sxs</span> contains 2 copies of <span class='highlight'>Superoxide dismutase [Cu-Zn]</span>. Top view.")
Chains: A, B
Length: 151 amino acids
Theoretical weight: 15.57 KDa
Source organism: Bos taurus
UniProt:
FASTA Sequence
Length: 151 amino acids
Theoretical weight: 15.57 KDa
Source organism: Bos taurus
UniProt:
- Canonical: P00442 (Residues: 2-152; Coverage: 99%)
FASTA Sequence
>pdb|1sxs|A B
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
PDBe-KB: UniProt Coverage View:
P00442