Snaclec convulxin subunit alpha in PDB entry 1uos ‹ PDBe

Chains: A, C
Length: 135 amino acids
Theoretical weight: 15.75 KDa
Source organism: Crotalus durissus terrificus
UniProt:

Canonical: O93426 (Residues: 24-158; Coverage: 100%)

FASTA Sequence


    >pdb|1uos|A C

GLHCPSDWYYYDQHCYRIFNEEMNWEDAEWFCTKQAKGAHLVSIKSAKEADFVAWMVTQNIEESFSHVSIGLRVQNKEKQCSTKWSDGSSVSYDNLLDLYITKCSLLKKETGFRKWFVASCIGKIPFVCKFPPQC

1uos:A

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.