Methyltransferase type 11 domain-containing protein in PDB entry 1vlm ‹ PDBe

Chains: A, B
Length: 219 amino acids
Theoretical weight: 25.7 KDa
Source organism: Thermotoga maritima MSB8
Expression system: Escherichia coli
UniProt:

Canonical: Q9X119 (Residues: 1-207; Coverage: 100%)

Gene name: TM_1293
FASTA Sequence


    >pdb|1vlm|A B

MGSDKIHHHHHHMWHIFERFVNEYERWFLVHRFAYLSELQAVKCLLPEGRGVEIGVGTGRFAVPLKIKIGVEPSERMAEIARKRGVFVLKGTAENLPLKDESFDFALMVTTICFVDDPERALKEAYRILKKGGYLIVGIVDRESFLGREYEKNKEKSVFYKNARFFSTEELMDLMRKAGFEEFKVVQTLFKHPSELSEIEPVKEGYGEGAFVVIRGTKK

1vlm:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.