Serine/arginine-rich splicing factor 9

Chain: A
Length: 98 amino acids
Theoretical weight: 10.86 KDa
Source organism: Mus musculus
Expression system: Not provided
UniProt:
  • Canonical: Q9D0B0 (Residues: 104-188; Coverage: 38%)
Gene names: Sfrs9, Srsf9
FASTA Sequence
>pdb|1wg4|A
GSSGSSGGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGMGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSSGPSSG
PDBe-KB: UniProt Coverage View: Q9D0B0  
Loading Protvista...
Loading...
 
 
  1wg4: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...