R3H domain-containing protein 2 in PDB entry 1whr ‹ PDBe

Chain: A
Length: 124 amino acids
Theoretical weight: 14.27 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:

Canonical: Q9Y2K5 (Residues: 147-257; Coverage: 11%)

Gene names: KIAA1002, R3HDM2
FASTA Sequence


    >pdb|1whr|A

GSSGSSGTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILEFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSNTRIPEQRFSEHIKDEKNTEFQQRFILSGPSSG

PDBe-KB: UniProt Coverage View: Q9Y2K5

Loading Protvista...

1whr:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.