› › Structure analysis

Solution structure of the C2H2 zinc finger domain of the protein arginine N-methyltransferase 3 from Mus musculus

Solution NMR
PDB entry 1wir coloured by chain, ensemble of 20 models, front view.
PDB entry 1wir coloured by chain, ensemble of 20 models, side view.
PDB entry 1wir coloured by chain, ensemble of 20 models, top view.
Source organism: Mus musculus
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Protein arginine N-methyltransferase 3
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 8777.68 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-187647

Macromolecules

Protein arginine N-methyltransferase 3
Chain: A
Length: 121 amino acids
Theoretical weight: 13.79 KDa
Source organism: Mus musculus
Expression system: Not provided
UniProt:
  • Canonical: Q922H1 (Residues: 37-145; Coverage: 21%)
Gene names: Hrmt1l3, Prmt3
Pfam:
InterPro:
SCOP: variant C2H2 finger
Protein arginine N-methyltransferase 3 in PDB entry 1wir, assembly 1, front view.
Protein arginine N-methyltransferase 3 in PDB entry 1wir, assembly 1, side view.
Protein arginine N-methyltransferase 3 in PDB entry 1wir, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q922H1  
1121102030405060708090100110120
 
50100GSSGSSGEPAHGRQHTPCLFCDRLFASAEETFSHCKLEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFDVEDLYEPVSTPFSSGPSSG
UniProt
Q922H1
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Sequence conservation
Molecule details ›

Search similar proteins

Quick links