Group 1 truncated hemoglobin GlbN in PDB entry 2gl3 ‹ PDBe

Chains: A, B
Length: 136 amino acids
Theoretical weight: 14.42 KDa
Source organism: Mycobacterium tuberculosis
Expression system: Escherichia coli
UniProt:

Canonical: P9WN25 (Residues: 1-136; Coverage: 100%)

Gene names: MTCY48.23, Rv1542c, glbN
FASTA Sequence


    >pdb|2gl3|A B

MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAPV

2gl3:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.