Griffithsin in PDB entry 2gud ‹ PDBe

Chains: A, B
Length: 122 amino acids
Theoretical weight: 12.73 KDa
Source organism: Griffithsia
Expression system: Nicotiana benthamiana
UniProt:

Canonical: P84801 (Residues: 1-121; Coverage: 100%)

FASTA Sequence


    >pdb|2gud|A B

XSLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY

PDBe-KB: UniProt Coverage View: P84801

2gud:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.