RNA-binding protein 8A in PDB entry 2hyi ‹ PDBe

Chains: B, H
Length: 91 amino acids
Theoretical weight: 10.37 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: Q9Y5S9 (Residues: 64-154; Coverage: 52%)

Gene names: HSPC114, MDS014, RBM8, RBM8A
FASTA Sequence


    >pdb|2hyi|B H

PGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGP

PDBe-KB: UniProt Coverage View: Q9Y5S9

Loading Protvista...

2hyi:B

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.