DUF655 domain-containing protein in PDB entry 2i5h ‹ PDBe

Chain: A
Length: 205 amino acids
Theoretical weight: 24.45 KDa
Source organism: Archaeoglobus fulgidus
Expression system: Escherichia coli
UniProt:

Canonical: O28741 (Residues: 2-195; Coverage: 100%)

Gene name: AF_1531
FASTA Sequence


    >pdb|2i5h|A

MSLEKPKVERSEGKEKLEDYAYVLDFMPYGHPDDKRPIHRREPLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGERDVVYKIKRRLRYEDLTPAAKTELPYVIEHIIKQDEKKYVDFFNKADSITTRMHQLELLPGVGKKMMWAIIEERKKRPFESFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTAEGHHHHHH

2i5h:A

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.