HTH-type dhaKLM operon transcriptional activator DhaS in PDB entry 2iu5 ‹ PDBe

Chains: A, B
Length: 195 amino acids
Theoretical weight: 23.57 KDa
Source organism: Lactococcus lactis subsp. lactis Il1403
Expression system: Escherichia coli BL21(DE3)
UniProt:

Canonical: Q9CIV9 (Residues: 1-187; Coverage: 100%)

Gene names: L45062, LL0247, dhaR, dhaS
FASTA Sequence


    >pdb|2iu5|A B

MSAFFLNMEKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELINDNSDYYGWQNELLLLLRYLDENQIFYQKIFVIDKNFEHFFLIQWENLLDKVIFDQEKKSDYHWSDLEKSFICRYNAAAICAITRESIIRGNSLEKLYSQIVNLLLAQIKIFESLEHHHHHH

2iu5:A

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.