Cellular tumor antigen p53 in PDB entry 2j10 ‹ PDBe

Chains: A, B, C, D
Length: 31 amino acids
Theoretical weight: 3.81 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:

Canonical: P04637 (Residues: 326-356; Coverage: 8%)

Gene names: P53, TP53
FASTA Sequence


    >pdb|2j10|A B C D

EYFFLKIRGRERFEMFRELNEALELKDAQAG

2j10:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.