Na(+)/H(+) exchange regulatory cofactor NHE-RF1 in PDB entry 2m0t ‹ PDBe

Chain: A
Length: 117 amino acids
Theoretical weight: 12.82 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: O14745 (Residues: 11-120; Coverage: 31%)

Gene names: NHERF, NHERF1, SLC9A3R1
FASTA Sequence


    >pdb|2m0t|A

GIDPFTMLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA

2m0t:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.