Disintegrin rhodostomin in PDB entry 2m7f ‹ PDBe

Chain: A
Length: 79 amino acids
Theoretical weight: 8.7 KDa
Source organism: Calloselasma rhodostoma
Expression system: Komagataella pastoris
UniProt:

Canonical: P30403 (Residues: 408-478; Coverage: 16%)

FASTA Sequence


    >pdb|2m7f|A

EFHHHHHHGKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIARGDWNDDRCTGQSADCPRNGLYG

2m7f:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.