E3 ubiquitin-protein ligase SHPRH

Chain: A
Length: 73 amino acids
Theoretical weight: 8.59 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: Q149N8 (Residues: 652-716; Coverage: 4%)
Gene names: KIAA2023, SHPRH
FASTA Sequence
>pdb|2m85|A
GSPNSRVDFNTSDYRFECICGELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTR
PDBe-KB: UniProt Coverage View: Q149N8  
Loading Protvista...
Loading...
 
 
  2m85:A 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...