Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein

Chain: A
Length: 142 amino acids
Theoretical weight: 16.14 KDa
Source organism: Cupriavidus metallidurans CH34
Expression system: Escherichia coli
UniProt:
  • Canonical: Q1LD49 (Residues: 1-134; Coverage: 100%)
Gene name: Rmet_5065
FASTA Sequence
>pdb|2n4b|A
MNITVETTVAAPVGKVWRAYTTPEDIKQWNAASDDWHTTAATVDLREGGAFSSRMEAKDGSMGFDFAGTYTKVVENKRIEYAFGDRTAKVEFLEAPQGVTVRVSFVAETEYPVEQQQQGWQAILNNFKRHVESHLEHHHHHH
PDBe-KB: UniProt Coverage View: Q1LD49  
Loading Protvista...
Loading...
 
 
  2n4b: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...