Ubiquitin-like protein NEDD8 in PDB entry 2nvu ‹ PDBe

Chains: I, J
Length: 81 amino acids
Theoretical weight: 8.92 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: Q15843 (Residues: 1-76; Coverage: 94%)

Gene name: NEDD8
FASTA Sequence


    >pdb|2nvu|I J

GSGGSMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG

PDBe-KB: UniProt Coverage View: Q15843

2nvu:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.