RNA polymerase sigma factor RpoN in PDB entry 2o9l ‹ PDBe

Chain: A
Length: 63 amino acids
Theoretical weight: 7.49 KDa
Source organism: Aquifex aeolicus
Expression system: Escherichia coli
UniProt:

Canonical: O66858 (Residues: 338-398; Coverage: 15%)

Gene names: aq_599, rpoN
FASTA Sequence


    >pdb|2o9l|A

HMLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREMLGIPSSRERRI

PDBe-KB: UniProt Coverage View: O66858

Loading Protvista...

2o9l:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.