Endolysin in PDB entry 2rbp ‹ PDBe

Chain: A
Length: 162 amino acids
Theoretical weight: 18.39 KDa
Source organism: Escherichia virus T4
Expression system: Escherichia coli
UniProt:

Canonical: P00720 (Residues: 1-162; Coverage: 99%)

Gene name: E
FASTA Sequence


    >pdb|2rbp|A

MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCAAINQVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK

2rbp:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.