PDBe-KB: UniProt Coverage View:
Q007T0
![Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial in PDB entry 3aed, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/3aed_entity_2_front_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>3aed</span> contains 1 copy of <span class='highlight'>Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial</span>. Front view.")
![Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial in PDB entry 3aed, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/3aed_entity_2_side_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>3aed</span> contains 1 copy of <span class='highlight'>Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial</span>. Side view.")
![Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial in PDB entry 3aed, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/3aed_entity_2_top_image-200x200.png "Hetero tetrameric assembly 1 of PDB entry <span class='highlight'>3aed</span> contains 1 copy of <span class='highlight'>Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial</span>. Top view.")
Chain: B
Length: 252 amino acids
Theoretical weight: 28.76 KDa
Source organism: Sus scrofa
UniProt:
FASTA Sequence
Length: 252 amino acids
Theoretical weight: 28.76 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: Q007T0 (Residues: 29-280; Coverage: 90%)
FASTA Sequence
>pdb|3aed|B
AQTAAATAPRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKEKKASA
PDBe-KB: UniProt Coverage View:
Q007T0