Large ribosomal subunit protein uL11 in PDB entry 3cme ‹ PDBe

Chain: I
Length: 162 amino acids
Theoretical weight: 17.1 KDa
Source organism: Haloarcula marismortui
UniProt:

Canonical: P14122 (Residues: 1-162; Coverage: 100%)

Gene names: rpl11, rrnAC1414
FASTA Sequence


    >pdb|3cme|I

MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA

3cme:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.