› › Fab fragment of anti-osteopontin antibody 23C3, Light chain

Fab fragment of anti-osteopontin antibody 23C3, Light chain in PDB entry 3dsf, assembly 1, front view.
Fab fragment of anti-osteopontin antibody 23C3, Light chain in PDB entry 3dsf, assembly 1, side view.
Fab fragment of anti-osteopontin antibody 23C3, Light chain in PDB entry 3dsf, assembly 1, top view.
Chain: L
Length: 213 amino acids
Theoretical weight: 23.07 KDa
Source organism: Mus musculus
FASTA Sequence
>pdb|3dsf|L
YIQMTQSPASLSVSVGETVTITCRASENIYSFLAWYQQKQGKSPQLLVYAATNLADGVPSRFSGSGSGTQFSLKINSLQSEDFGTYYCQHFWGTPFTFGSGTKLEIKRSDAAPTVSIFPPSAAQLSSGGGSVVCFLNNFYPKDINVKWKIDGAERGNGVLNSWTSQDSADSTYSMSSTLTSGGDEYERHNSYTCEATHKTSTSPIVKSFNRAA
121320406080100120140160180200
 
100200
Chains
RSRZ Outlier Chain A (auth L)
Chain A (auth L)
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Sequence conservation
Loading...
 
 
  3dsf: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins