Arsenical resistance operon trans-acting repressor ArsD in PDB entry 3mwh ‹ PDBe

Chains: A, B
Length: 110 amino acids
Theoretical weight: 12.02 KDa
Source organism: Escherichia coli
Expression system: Escherichia coli
UniProt:

Canonical: P46003 (Residues: 1-109; Coverage: 91%)

Gene name: arsD
FASTA Sequence


    >pdb|3mwh|A B

MKTLMVFDPAMCCSTGVCGTDVDQALVDFSTDVQWLKQCGVQIERFNLAQQPMSFVQNEKVKAFIEASGAEGLPLLLLDGETVMAGRYPKRAELARWFGIPLDKVGLAPG

PDBe-KB: UniProt Coverage View: P46003

Loading Protvista...

3mwh:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.