Hemoglobin subunit alpha in PDB entry 3qjb ‹ PDBe

Chain: A
Length: 141 amino acids
Theoretical weight: 15.13 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: P69905 (Residues: 2-142; Coverage: 99%)

Gene names: HBA1, HBA2
FASTA Sequence


    >pdb|3qjb|A

VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGLGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

3qjb:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Hide sections

	Curated metal binding sites
	Curated interface annotations
	Predicted functional sites
	Predicted PTM sites
	Predicted ligand binding sites
	Molecular channels
	Biophysical parameters