› › Adalimumab Heavy Chain

Adalimumab Heavy Chain in PDB entry 3wd5, assembly 1, front view.
Adalimumab Heavy Chain in PDB entry 3wd5, assembly 1, side view.
Adalimumab Heavy Chain in PDB entry 3wd5, assembly 1, top view.
Chain: H
Length: 219 amino acids
Theoretical weight: 23.27 KDa
Source organism: Homo sapiens
Expression system: Cricetulus griseus
FASTA Sequence
>pdb|3wd5|H
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGRFTISRDNAKNSLYLDMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKI
121920406080100120140160180200
 
100200
Chains
RSRZ Outlier Chain C (auth H)
Chain C (auth H)
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Loading...
 
 
  3wd5:H 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins