UBC core domain-containing protein in PDB entry 4ds2 ‹ PDBe

Chains: A, B
Length: 167 amino acids
Theoretical weight: 18.73 KDa
Source organism: Trypanosoma cruzi
Expression system: Escherichia coli
UniProt:

Canonical: Q4DIQ3 (Residues: 1-163; Coverage: 100%)

Gene name: Tc00.1047053506635.90
FASTA Sequence


    >pdb|4ds2|A B

GPGSMKNISNKRIIKDLKLLLEEVDANNEANSSGSPHSTAIFSVDTDTIYNWILKVKAPADSVYGGAGNTYQLSVLFSDDYPHEPPTVRFVTPVYSPLVTGEGGICDRMVNDFWTPDQHASDVIKLVLDRVFSQYKSRRDDDVNPEARHYLEKFPQDFAARVRRGRG

4ds2:A

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.