Small ribosomal subunit protein uS12 in PDB entry 4dv3 ‹ PDBe

Chain: L
Length: 135 amino acids
Theoretical weight: 14.97 KDa
Source organism: Thermus thermophilus HB8
UniProt:

Canonical: Q5SHN3 (Residues: 1-132; Coverage: 100%)

Gene names: TTHA1697, rpsL
FASTA Sequence


    >pdb|4dv3|L

MVALPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK

PDBe-KB: UniProt Coverage View: Q5SHN3

Loading Protvista...

4dv3:L

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.