› › Small ribosomal subunit protein uS13

Small ribosomal subunit protein uS13 in PDB entry 4dv3, assembly 1, front view.
Small ribosomal subunit protein uS13 in PDB entry 4dv3, assembly 1, side view.
Small ribosomal subunit protein uS13 in PDB entry 4dv3, assembly 1, top view.
Chain: M
Length: 126 amino acids
Theoretical weight: 14.34 KDa
Source organism: Thermus thermophilus HB8
UniProt:
  • Canonical: P80377 (Residues: 1-126; Coverage: 100%)
Gene names: TTHA1667, rps13, rpsM
FASTA Sequence
>pdb|4dv3|M
MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
PDBe-KB: UniProt Coverage View: P80377  
Loading Protvista...
Loading...
 
 
  4dv3: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins