› › Large ribosomal subunit protein bL28

Large ribosomal subunit protein bL28 in PDB entry 4l71, assembly 1, front view.
Large ribosomal subunit protein bL28 in PDB entry 4l71, assembly 1, side view.
Large ribosomal subunit protein bL28 in PDB entry 4l71, assembly 1, top view.
Chains: R1, Y1
Length: 98 amino acids
Theoretical weight: 11 KDa
Source organism: Thermus thermophilus HB8
UniProt:
  • Canonical: P60494 (Residues: 1-98; Coverage: 100%)
Gene names: TTHA0042, rpmB
FASTA Sequence
>pdb|4l71|R1 Y1
MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL
PDBe-KB: UniProt Coverage View: P60494  
Loading Protvista...
Loading...
 
 
  4l71: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins