Catechol O-methyltransferase in PDB entry 4p58 ‹ PDBe

Chain: A
Length: 212 amino acids
Theoretical weight: 23.83 KDa
Source organism: Mus musculus
Expression system: Escherichia coli
UniProt:

Canonical: O88587 (Residues: 47-258; Coverage: 80%)
Best match: O88587-2 (Residues: 4-215)

Gene names: Comt, Comt1
FASTA Sequence


    >pdb|4p58|A

TKEQRILRYVQQNAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDYAAITQQMLNFAGLQDKVTILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP

4p58:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.