› › Photosystem II extrinsic protein V

Photosystem II extrinsic protein V in PDB entry 4ub6, assembly 1, front view.
Photosystem II extrinsic protein V in PDB entry 4ub6, assembly 1, side view.
Photosystem II extrinsic protein V in PDB entry 4ub6, assembly 1, top view.
Chains: V, v
Length: 137 amino acids
Theoretical weight: 15.15 KDa
Source organism: Thermostichus vulcanus
UniProt:
  • Canonical: P0A387 (Residues: 27-163; Coverage: 100%)
Gene name: psbV
FASTA Sequence
>pdb|4ub6|V v
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
PDBe-KB: UniProt Coverage View: P0A387  
Loading Protvista...
Loading...
 
 
  4ub6: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins