› › 50S ribosomal protein L19E

50S ribosomal protein L19E in PDB entry 4v4n, assembly 1, front view.
50S ribosomal protein L19E in PDB entry 4v4n, assembly 1, side view.
50S ribosomal protein L19E in PDB entry 4v4n, assembly 1, top view.
Chain: AQ
Length: 150 amino acids
Theoretical weight: 17.92 KDa
Source organism: Methanocaldococcus jannaschii
FASTA Sequence
>pdb|4v4n|AQ
MNTLKMQRRIAAEILKCGENRIWIDPERIDDVASAITREDIKRLIKEGVIKKKPIKGQSRYRAKIRHEQKKKGRHRGPGSRKGKKTARMGKKELWIKTIRALRKELRKLKAQKKIDRKTYRMLYIRAKGGQFKNKHQLYLFLEEHGLLKK
115020406080100120140
 
50100150
Chains
Chain D (auth AQ)
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Sequence conservation
 
NC
 
  4v4n:AQ 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins