› › 50S ribosomal protein L32E

50S ribosomal protein L32E in PDB entry 4v4n, assembly 1, front view.
50S ribosomal protein L32E in PDB entry 4v4n, assembly 1, side view.
50S ribosomal protein L32E in PDB entry 4v4n, assembly 1, top view.
Chain: Ab
Length: 127 amino acids
Theoretical weight: 15.23 KDa
Source organism: Methanocaldococcus jannaschii
FASTA Sequence
>pdb|4v4n|Ab
EKEFKRLLRVRARLKRKKPRFLRQEWWRYPKFKNDPKWRRPKGIDSKMRLKLKGKPRSPSIGWSSPKLVRGLHPSGYEEVLVHNVKELEALDPKRQAARIAHTVGKKKRIEIIKRAEELGIKVLNPR
1127102030405060708090100110120
 
50100
Chains
Chain RA (auth Ab)
Domains
Flexibility predictions
Early folding residue predictions
Sequence conservation
 
NC
 
  4v4n:Ab 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins