› › 50S ribosomal protein L44E

50S ribosomal protein L44E in PDB entry 4v4n, assembly 1, front view.
50S ribosomal protein L44E in PDB entry 4v4n, assembly 1, side view.
50S ribosomal protein L44E in PDB entry 4v4n, assembly 1, top view.
Chain: Aj
Length: 94 amino acids
Theoretical weight: 11.23 KDa
Source organism: Methanocaldococcus jannaschii
FASTA Sequence
>pdb|4v4n|Aj
MKYPKQIRTYCPFCKKHTIHKVERVKKRPRSELSAGQRRFRRILKGYGGFPRPKPEGREKPVKKLDLRFRCTECGKAHTRGRGFRVKKFELVEG
194102030405060708090
 
20406080MKYPKQIRTYCPFCKKHTIHKVERVKKRPRSELSAGQRRFRRILKGYGGFPRPKPEGREKPVKKLDLRFRCTECGKAHTRGRGFRVKKFELVEG
Chains
Chain FB (auth Aj)
Domains
Flexibility predictions
Early folding residue predictions
Sequence conservation
 
NC
 
  4v4n:Aj 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins