Small ribosomal subunit protein bS21

Chain: AQ
Length: 71 amino acids
Theoretical weight: 8.52 KDa
Source organism: Escherichia coli
UniProt:
  • Canonical: P68679 (Residues: 1-71; Coverage: 100%)
Gene names: JW3037, b3065, rpsU
FASTA Sequence
>pdb|4v65|AQ
MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY
PDBe-KB: UniProt Coverage View: P68679  
Loading Protvista...
Loading...
 
 
  4v65: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.