› › H5.3 FAB Heavy Chain

H5.3 FAB Heavy Chain in PDB entry 4xnm, assembly 1, front view.
H5.3 FAB Heavy Chain in PDB entry 4xnm, assembly 1, side view.
H5.3 FAB Heavy Chain in PDB entry 4xnm, assembly 1, top view.
Chains: B, H
Length: 227 amino acids
Theoretical weight: 23.96 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
FASTA Sequence
>pdb|4xnm|B H
QVQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVELKTPT
122720406080100120140160180200220
 
100200
Chains
RSRZ Outlier Chain B (auth H)
Chain B (auth H)
RSRZ Outlier Chain D (auth B)
Chain D (auth B)
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Loading...
 
 
  4xnm:H 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins