Tail completion protein gp17 in PDB entry 5a21 ‹ PDBe

Chain: G
Length: 134 amino acids
Theoretical weight: 15.03 KDa
Source organism: Bacillus phage SPP1
UniProt:

Canonical: O48448 (Residues: 1-134; Coverage: 100%)

FASTA Sequence


    >pdb|5a21|G

MTWKLASRALQKATVENLESYQPLMEMVNQVTESPGKDDPYPYVVIGDQSSTPFETKSSFGENITMDFHVWGGTTRAEAQDISSRVLEALTYKPLMFEGFTFVAKKLVLAQVITDTDGVTKHGIIKVRFTINNN

5a21:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.