› › 50S ribosomal protein L6

50S ribosomal protein L6 in PDB entry 5hcq, assembly 2, front view.
50S ribosomal protein L6 in PDB entry 5hcq, assembly 2, side view.
50S ribosomal protein L6 in PDB entry 5hcq, assembly 2, top view.
Chains: 1H, 2H
Length: 180 amino acids
Theoretical weight: 19.57 KDa
Source organism: Thermus thermophilus HB8
FASTA Sequence
>pdb|5hcq|1H 2H
MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK
118020406080100120140160180
 
50100150
Chains
RSRZ Outlier Chain G (auth 1H)
Chain G (auth 1H)
RSRZ Outlier Chain JB (auth 2H)
Chain JB (auth 2H)
Domains
Flexibility predictions
Early folding residue predictions
Loading...
 
 
  5hcq: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins