General control transcription factor GCN4 in PDB entry 5iiv ‹ PDBe

Chains: A, B
Length: 33 amino acids
Theoretical weight: 3.84 KDa
Source organism: Saccharomyces cerevisiae
Expression system: Escherichia coli
UniProt:

Canonical: P03069 (Residues: 250-280; Coverage: 11%)

Gene names: AAS101, AAS3, ARG9, GCN4, YEL009C
FASTA Sequence


    >pdb|5iiv|A B

GSMKQLEDKVEELLSKNYHLENEVARLKKLVGE

5iiv:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.