Inner membrane protein YgaP in PDB entry 5lam ‹ PDBe

Chain: A
Length: 108 amino acids
Theoretical weight: 11.72 KDa
Source organism: Escherichia coli K-12
Expression system: Escherichia coli BL21(DE3)
UniProt:

Canonical: P55734 (Residues: 2-109; Coverage: 62%)

Gene names: JW2643, b2668, ygaP
FASTA Sequence


    >pdb|5lam|A

ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQ

PDBe-KB: UniProt Coverage View: P55734

Loading Protvista...

5lam:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.