NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

Chain: X
Length: 169 amino acids
Theoretical weight: 18.12 KDa
Source organism: Bos taurus
FASTA Sequence
>pdb|5ldw|X
MPGIVELPSLEDLKVQEVKVSSSVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNQCALEFFRQIKRHCAEPFTEYWTCIDYSGLQLFRRCRKQQAQFDECVLDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading Protvista...
Loading...
 
 
  5ldw:X 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...