![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 5ldx, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5ldx_entity_2_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5ldx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 5ldx, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5ldx_entity_2_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5ldx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial in PDB entry 5ldx, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5ldx_entity_2_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>5ldx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial</span>. Top view.")
Chain: B
Length: 179 amino acids
Theoretical weight: 20.1 KDa
Source organism: Bos taurus
Length: 179 amino acids
Theoretical weight: 20.1 KDa
Source organism: Bos taurus
>pdb|5ldx|B
PSSTQPAVSQARAVVPKPAALPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR