O PanAsia VP4 in PDB entry 5ner ‹ PDBe

Chain: 4
Length: 70 amino acids
Theoretical weight: 7.52 KDa
Source organism: Foot-and-mouth disease virus
Expression system: Cricetinae gen. sp.
UniProt:

Canonical: A6Y878 (Residues: 218-287; Coverage: 3%)

FASTA Sequence


    >pdb|5ner|4

SGNTGSIINNYYMQQYQNSMDTQLGDNAISGGSNEGSLTYFPHTTNTQNNDWFSKLASSAFSGLFGALLA

5ner:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.