› › DNA-directed RNA polymerases I, II, and III subunit RPABC4

DNA-directed RNA polymerases I, II, and III subunit RPABC4 in PDB entry 5oik, assembly 1, front view.
DNA-directed RNA polymerases I, II, and III subunit RPABC4 in PDB entry 5oik, assembly 1, side view.
DNA-directed RNA polymerases I, II, and III subunit RPABC4 in PDB entry 5oik, assembly 1, top view.
Chain: L
Length: 58 amino acids
Theoretical weight: 7.02 KDa
Source organism: Bos taurus
UniProt:
  • Canonical: Q3ZBC0 (Residues: 1-58; Coverage: 100%)
Gene name: POLR2K
FASTA Sequence
>pdb|5oik|L
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
PDBe-KB: UniProt Coverage View: Q3ZBC0  
Loading Protvista...
Loading...
 
 
  5oik: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins