DNA-directed RNA polymerase subunit omega

Chain: E
Length: 110 amino acids
Theoretical weight: 11.85 KDa
Source organism: Mycobacterium tuberculosis H37Rv
Expression system: Escherichia coli 'BL21-Gold(DE3)pLysS AG'
UniProt:
  • Canonical: P9WGY5 (Residues: 1-110; Coverage: 100%)
Gene names: MTCY21B4.07, Rv1390, rpoZ
FASTA Sequence
>pdb|5uhb|E
MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHADLLEHTEGE
PDBe-KB: UniProt Coverage View: P9WGY5  
Loading Protvista...
Loading...
 
 
  5uhb: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...