Ubiquitin-conjugating enzyme E2 N in PDB entry 5vo0 ‹ PDBe

Chains: B, E
Length: 157 amino acids
Theoretical weight: 17.57 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21
UniProt:

Canonical: P61088 (Residues: 1-152; Coverage: 100%)

Gene names: BLU, UBE2N
FASTA Sequence


    >pdb|5vo0|B E

GPLGSMAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRIKLDILTDQWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI

PDBe-KB: UniProt Coverage View: P61088

Loading Protvista...

5vo0:E

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.