PDBe-KB: UniProt Coverage View:
Q4U443
![[acyl-carrier-protein] S-malonyltransferase in PDB entry 5zk4, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/5zk4_entity_1_front_image-200x200.png "Monomeric assembly 1 of PDB entry <span class='highlight'>5zk4</span> contains 1 copy of <span class='highlight'>[acyl-carrier-protein] S-malonyltransferase</span>. Front view.")
![[acyl-carrier-protein] S-malonyltransferase in PDB entry 5zk4, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/5zk4_entity_1_side_image-200x200.png "Monomeric assembly 1 of PDB entry <span class='highlight'>5zk4</span> contains 1 copy of <span class='highlight'>[acyl-carrier-protein] S-malonyltransferase</span>. Side view.")
![[acyl-carrier-protein] S-malonyltransferase in PDB entry 5zk4, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/5zk4_entity_1_top_image-200x200.png "Monomeric assembly 1 of PDB entry <span class='highlight'>5zk4</span> contains 1 copy of <span class='highlight'>[acyl-carrier-protein] S-malonyltransferase</span>. Top view.")
Chains: A, B
Length: 302 amino acids
Theoretical weight: 33.12 KDa
Source organism: Sorangium cellulosum
Expression system: Escherichia coli BL21(DE3)
UniProt:
FASTA Sequence
Length: 302 amino acids
Theoretical weight: 33.12 KDa
Source organism: Sorangium cellulosum
Expression system: Escherichia coli BL21(DE3)
UniProt:
- Canonical: Q4U443 (Residues: 1-286; Coverage: 34%)
FASTA Sequence
>pdb|5zk4|A B
MNHKVHHHHHHIEGRHMKAYMFPGQGSQAKGMGRALFDAFPALTARADGVLGYSIRALCQDDPDQRLSQTQFTQPALYVVNALSYLKRREEEAPPDFLAGHCLGEFSALFAAGVFDFETGLALVKKRGELMGDARGGGMAAVIGLDEERVRELLDQNGATAVDIANLNSPSQVVISGAKDEIARLQVPFEAAGAKKYTVLRVSAAFHSRFMRPAMVEFGRFLEGYDFAPPKIPVISNVTARPCKADGIRAALSEQIASPVRWCESIRYLMGRGVEEFVECGHGIVLTGLYAQIRRDAQPLVV
PDBe-KB: UniProt Coverage View:
Q4U443