Guanine nucleotide-binding protein G(T) subunit gamma-T1

Chains: C, D
Length: 60 amino acids
Theoretical weight: 7.13 KDa
Source organism: Bos taurus
UniProt:
  • Canonical: P02698 (Residues: 7-66; Coverage: 81%)
Gene name: GNGT1
FASTA Sequence
>pdb|6b20|C D
EDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEFRDYVEERSGEDPLVKGIPEDKNPFKE
PDBe-KB: UniProt Coverage View: P02698  
Loading Protvista...
Loading...
 
 
  6b20: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...