› › SH3 and multiple ankyrin repeat domains protein 2

SH3 and multiple ankyrin repeat domains protein 2 in PDB entry 6cpj, assembly 1, front view.
SH3 and multiple ankyrin repeat domains protein 2 in PDB entry 6cpj, assembly 1, side view.
SH3 and multiple ankyrin repeat domains protein 2 in PDB entry 6cpj, assembly 1, top view.
Chain: A
Length: 61 amino acids
Theoretical weight: 6.74 KDa
Source organism: Rattus norvegicus
Expression system: Escherichia coli
UniProt:
  • Canonical: Q9QX74 (Residues: 148-206; Coverage: 4%)
Gene names: Cortbp1, Shank2
FASTA Sequence
>pdb|6cpj|A
MVPGRLFVAIKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQS
PDBe-KB: UniProt Coverage View: Q9QX74  

Quick links

Search similar proteins