Histone H2A type 1 in PDB entry 6g0l ‹ PDBe

Chain: C
Length: 130 amino acids
Theoretical weight: 14.19 KDa
Source organism: Xenopus laevis
Expression system: Escherichia coli

FASTA Sequence


    >pdb|6g0l|C

MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGRVLPNIQSVLLPKKTESAKSAKSK

6g0l:C

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.